PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AL_140B829CB.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 345aa    MW: 37653.6 Da    PI: 7.6622
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AL_140B829CB.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.22.9e-32194251259
                            --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            +Dgy+WrKYGqK vk+s++prsYYrCt+++C vkk+vers +dp++v++tYeg+H+h+
  Traes_3AL_140B829CB.2 194 EDGYRWRKYGQKAVKNSPYPRSYYRCTTPKCGVKKRVERSYQDPSTVITTYEGQHTHH 251
                            8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.6E-34180253IPR003657WRKY domain
SuperFamilySSF1182906.8E-29186253IPR003657WRKY domain
PROSITE profilePS5081131.066188253IPR003657WRKY domain
SMARTSM007741.6E-37193252IPR003657WRKY domain
PfamPF031062.0E-25194251IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MSSGGGGGGD QGRHGLYHQH GHGQLTRYDG AGGYELSNDD MESFFFSQPE GVGGGVRADE  60
IAPYSSITSY LQGFLDPTGL ARHLDVPAKH ELSVDVRSHD QDSQGTGSAA GESAALLTPN  120
SSVSFSSGGG DGEGKSRRSK KGRAQEPDDQ EDGKDHEDGE SSKTANNKPK KKAEKRPRLP  180
RVSFLTKSEV DHLEDGYRWR KYGQKAVKNS PYPRSYYRCT TPKCGVKKRV ERSYQDPSTV  240
ITTYEGQHTH HSPASLRGSA AHLFMPPGLH GLPPPHLIPP GVFHPELMSM MRMPYPSPNM  300
HLLSVPPPPH HHPTSHPMAG TLQQYHFTDY ALLQDLSTST MPNNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-291862541078Probable WRKY transcription factor 4
1wj2_A2e-291862541078Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566905.11e-131PREDICTED: probable WRKY transcription factor 71
TrEMBLM8AKQ30.0M8AKQ3_TRIUA; Putative WRKY transcription factor 71
TrEMBLW5CAT10.0W5CAT1_WHEAT; Uncharacterized protein
STRINGBRADI2G44090.11e-130(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62337173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18170.12e-47WRKY DNA-binding protein 28
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]